PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400038283
Common NameLOC102590856
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 749aa    MW: 81041 Da    PI: 6.4407
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400038283genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.36.6e-33323380260
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           +DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  +++++ei+Y+g Hnh+k
  PGSC0003DMP400038283 323 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSP-EGHITEIIYKGAHNHPK 380
                           8****************************************.***************85 PP

2WRKY104.17.6e-33538596159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++d k v++tYeg+Hnh+
  PGSC0003DMP400038283 538 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCNVRKHVERASHDLKSVITTYEGKHNHD 596
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.135317381IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.8E-29320381IPR003657WRKY domain
SuperFamilySSF1182907.06E-26321381IPR003657WRKY domain
SMARTSM007741.4E-36322380IPR003657WRKY domain
PfamPF031062.7E-25323379IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.5E-37523598IPR003657WRKY domain
SuperFamilySSF1182901.57E-28530598IPR003657WRKY domain
PROSITE profilePS5081138.733533598IPR003657WRKY domain
SMARTSM007746.6E-38538597IPR003657WRKY domain
PfamPF031065.2E-25539596IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 749 aa     Download sequence    Send to blast
MGGFDDHVAI MGDWMPPSPS PRTFFSSLLG DDVGSRSSFE GTNETSGNLA SGPQEHVGNS  60
DRNDGAQAAI SEPQPVKFSA LSDQKMSSRG GGLLERIAAR AGFNAPKLNT ESLRPADLMQ  120
NQGVRSPYLT IPPGLSPTTL LESPVFLSNS LVQPSPTTGK FLFSSGIENR NSALMMEDTD  180
KRKDNALESI NSSSFSFKPV PETAPSLFPG TTSRSWLQVN PSNFSQQGFP NIEVSVHSQN  240
SLVSHRVEAT QNPTQSGTLQ QSSDFPRFSA EKDVMGNNVT LESRTFQTVG SAVDHSPPLD  300
EPQDEDIDQR GGGDPNVAGA PAEDGYNWRK YGQKQVKGSE YPRSYYKCTH PNCPVKKKVE  360
RSPEGHITEI IYKGAHNHPK PPPNRRSALG STNSLGDLQL DGAEQGASGV NGDLGQANFQ  420
KAPGAGGGFD WRNNNLDATS SANLGSEYCN RSAPFSAQNN TRLESGDAVD VSSTFSNDED  480
EDDRGTHGSV SQGYDGEGDE SESKRRKLET YSADMTGATR AIREPRVVVQ TTSEVDILDD  540
GYRWRKYGQK VVKGNPNPRS YYKCTSAGCN VRKHVERASH DLKSVITTYE GKHNHDVPAA  600
RNSSHVNSGA SNTHPTSVTG PAQNHLHRPE AAQLQNAMAQ FDRQPSLGSF GLSRRPQLGP  660
NPGFSYGMNQ QGGLSSLAMA GFHPNQNKPG EFHMHPYLGQ PRPMHDMGFM FPKEEPKVEP  720
MSDPGLNLAN GSAVYQQFMN RLPLGPQM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-37323599878Probable WRKY transcription factor 4
2lex_A6e-37323599878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7111240.0AB711124.1 Solanum tuberosum StWRKY11 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006346068.10.0PREDICTED: probable WRKY transcription factor 2 isoform X1
RefseqXP_006346069.10.0PREDICTED: probable WRKY transcription factor 2 isoform X1
RefseqXP_015163627.10.0PREDICTED: probable WRKY transcription factor 2 isoform X1
RefseqXP_015163628.10.0PREDICTED: probable WRKY transcription factor 2 isoform X1
SwissprotQ9FG770.0WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLM1C0470.0M1C047_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000569520.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37112341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.10.0WRKY DNA-binding protein 2
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]